SCOP 1.69: Domain d1ueaa_: 1uea A:

Lineage for d1ueaa_ (1uea A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (31 PDB entries)

8. Domain d1ueaa_: 1uea A: [40365]
   Other proteins in same PDB: d1ueab_, d1uead_

Details for d1ueaa_

PDB Entry: 1uea, 2.8 Å

PDB Description: mmp-3/timp-1 complex

SCOP Domain Sequences for d1ueaa_:

Sequence; same for both SEQRES and ATOM records:

>d1ueaa_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp

Timeline for d1ueaa_:

• d1ueaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ueaa_ appears in SCOP 1.67
  
• d1ueaa_ appears in SCOP 1.71
  
• d1ueaa_ appears in the current release, SCOPe 2.08