Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (10 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [278808] (54 PDB entries) |
Domain d7lvrb1: 7lvr B:1-243 [403646] Other proteins in same PDB: d7lvra2, d7lvrb2, d7lvrk1, d7lvrk2 automated match to d4drxb1 complexed with adp, af3, gdp, gtp, mg, ta1 |
PDB Entry: 7lvr (more details), 2.9 Å
SCOPe Domain Sequences for d7lvrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7lvrb1 c.32.1.1 (B:1-243) automated matches {Pig (Sus scrofa) [TaxId: 9823]} mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl rfp
Timeline for d7lvrb1:
View in 3D Domains from other chains: (mouse over for more information) d7lvra1, d7lvra2, d7lvrk1, d7lvrk2 |