SCOPe 2.08: Domain d7m0ta_: 7m0t A:

Lineage for d7m0ta_ (7m0t A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d7m0ta_: 7m0t A: [403620]
   Other proteins in same PDB: d7m0tb_
   automated match to d4e26a_
   complexed with 3ew, anp, mg

Details for d7m0ta_

PDB Entry: 7m0t, 3.19 Å

PDB Description: crystal structure of the braf:mek1 kinases in complex with amppnp and selumetinib

PDB Compounds: (A:) Serine/threonine-protein kinase B-raf

SCOPe Domain Sequences for d7m0ta_:

Sequence; same for both SEQRES and ATOM records:

>d7m0ta_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrk
trhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdyl
haksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmapevirm
qdknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpk
amkrlmaeclkkkrderplfpqilasiellarsl

Timeline for d7m0ta_:

• d7m0ta_ first appeared in SCOPe 2.07