Lineage for d1sln__ (1sln -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) 
Protein Stromelysin-1 (MMP-3) [55536] (1 species) Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (24 PDB entries) 
Domain d1sln__: 1sln - [40362]
Details for d1sln__
PDB Entry: 1sln (more details), 2.27 Å
PDB Description: crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited with the n-carboxy-alkyl inhibitor l-702,842
SCOP Domain Sequences for d1sln__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sln__ d.92.1.11 (-) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp
SCOP Domain Coordinates for d1sln__:
Click to download the PDB-style file with coordinates for d1sln__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sln__:
- d1sln__ appears in SCOP 1.57
- d1sln__ appears in the current release, SCOPe 2.08, called d1slna_
View in 3D