Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186847] (22 PDB entries) |
Domain d7lvrk1: 7lvr K:391-743 [403596] Other proteins in same PDB: d7lvra1, d7lvra2, d7lvrb1, d7lvrb2, d7lvrk2 automated match to d3gbja_ complexed with adp, af3, gdp, gtp, mg, ta1 |
PDB Entry: 7lvr (more details), 2.9 Å
SCOPe Domain Sequences for d7lvrk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7lvrk1 c.37.1.0 (K:391-743) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nsqvtvavrvrpfskrektekasqvvftngeeitvehpdmkqvysfiydvsfwsfdechp gyasqttvyetlaaplldrafegyntclfaygqtgsgksytmmglneepgiiprfcedlf aqiakkqtsevsyhlemsffevynekihdllvckgengqrkqplrarehpvsgpyvegls mnvvssysdiqswlelgnkqrataatgmndkssrshsvftlvmtqtktevvegeehdhri tsrinlvdlagsercstahssgqrlkegvsinkslltlgkvisalseqangkrvfipyre stltwllkeslggnsktamiatvspaasnieetlstlryatqarlivniakvn
Timeline for d7lvrk1:
View in 3D Domains from other chains: (mouse over for more information) d7lvra1, d7lvra2, d7lvrb1, d7lvrb2 |