Lineage for d7lwca_ (7lwc A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2413761Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2413784Protein beta-Lactoglobulin [50827] (4 species)
  7. 2413879Species Goat (Capra hircus) [TaxId:9925] [267757] (3 PDB entries)
  8. 2413883Domain d7lwca_: 7lwc A: [403587]
    automated match to d4tlja_
    mutant

Details for d7lwca_

PDB Entry: 7lwc (more details), 3 Å

PDB Description: goat beta-lactoglobulin mutant q59a
PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d7lwca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lwca_ b.60.1.1 (A:) beta-Lactoglobulin {Goat (Capra hircus) [TaxId: 9925]}
tqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegnleillakwen
gecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqclv
rtpevdkealekfdkalkalpmhirlafnptqlegqc

SCOPe Domain Coordinates for d7lwca_:

Click to download the PDB-style file with coordinates for d7lwca_.
(The format of our PDB-style files is described here.)

Timeline for d7lwca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d7lwcb_