Lineage for d7m3xa_ (7m3x A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808917Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2808918Family b.69.4.1: WD40-repeat [50979] (17 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 2809096Protein automated matches [190346] (4 species)
    not a true protein
  7. 2809118Species Human (Homo sapiens) [TaxId:9606] [311290] (6 PDB entries)
  8. 2809120Domain d7m3xa_: 7m3x A: [403543]
    automated match to d3c99a_
    protein/DNA complex; complexed with unx

Details for d7m3xa_

PDB Entry: 7m3x (more details), 1.46 Å

PDB Description: crystal structure of the apo form of human rbbp7
PDB Compounds: (A:) Histone-binding protein RBBP7

SCOPe Domain Sequences for d7m3xa_:

Sequence, based on SEQRES records: (download)

>d7m3xa_ b.69.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edtveervineeykiwkkntpflydlvmthalqwpsltvqwlpevtkpegkdyalhwlvl
gthtsdeqnhlvvarvhipnddaqfdashcdsdkgefggfgsvtgkieceikinhegevn
rarympqnphiiatktpssdvlvfdytkhpakpdpsgecnpdlrlrghqkegyglswnsn
lsghllsasddhtvclwdinagpkegkivdakaiftghsavvedvawhllheslfgsvad
dqklmiwdtrsnttskpshlvdahtaevnclsfnpysefilatgsadktvalwdlrnlkl
klhtfeshkdeifqvhwsphnetilassgtdrrlnvwdlskigeeqsaedaedgppellf
ihgghtakisdfswnpnepwvicsvsednimqiwqmaeniyn

Sequence, based on observed residues (ATOM records): (download)

>d7m3xa_ b.69.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edtveervineeykiwkkntpflydlvmthalqwpsltvqwlpevtkpegkdyalhwlvl
gthtsdeqnhlvvarvhipnddgkieceikinhegevnrarympqnphiiatktpssdvl
vfdytkhpakpdpsgecnpdlrlrghqkegyglswnsnlsghllsasddhtvclwdinag
pgkivdakaiftghsavvedvawhllheslfgsvaddqklmiwdtrsnttskpshlvdah
taevnclsfnpysefilatgsadktvalwdlrnlklklhtfeshkdeifqvhwsphneti
lassgtdrrlnvwdlskigeeqsaedaedgppellfihgghtakisdfswnpnepwvics
vsednimqiwqmaeniyn

SCOPe Domain Coordinates for d7m3xa_:

Click to download the PDB-style file with coordinates for d7m3xa_.
(The format of our PDB-style files is described here.)

Timeline for d7m3xa_: