Lineage for d1a86a_ (1a86 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205557Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2205812Protein Neutrophil collagenase (MMP-8) [55532] (1 species)
  7. 2205813Species Human (Homo sapiens) [TaxId:9606] [55533] (24 PDB entries)
  8. 2205838Domain d1a86a_: 1a86 A: [40354]
    complexed with 0zb, ca, zn

Details for d1a86a_

PDB Entry: 1a86 (more details), 2 Å

PDB Description: mmp8 with malonic and aspartic acid based inhibitor
PDB Compounds: (A:) mmp-8

SCOPe Domain Sequences for d1a86a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a86a_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]}
npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq
rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
lahssdpgalmypnyafretsnyslpqddidgiqaiyg

SCOPe Domain Coordinates for d1a86a_:

Click to download the PDB-style file with coordinates for d1a86a_.
(The format of our PDB-style files is described here.)

Timeline for d1a86a_: