SCOPe 2.08: Domain d7luoc2: 7luo C:4310-4432

Lineage for d7luoc2 (7luo C:4310-4432)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
   Uniprot P20248 175-432

8. Domain d7luoc2: 7luo C:4310-4432 [403525]
   automated match to d3ddqb2

Details for d7luoc2

PDB Entry: 7luo, 3.17 Å

PDB Description: n-terminus of skp2 bound to cyclin a

PDB Compounds: (C:) S-phase kinase-associated protein 2,Cyclin-A2

SCOPe Domain Sequences for d7luoc2:

Sequence; same for both SEQRES and ATOM records:

>d7luoc2 a.74.1.1 (C:4310-4432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d7luoc2:

• d7luoc2 first appeared in SCOPe 2.07