Lineage for d7luoc1 (7luo C:2078-4309)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718090Protein Cyclin A [47956] (2 species)
  7. 2718126Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
    Uniprot P20248 175-432
  8. 2718355Domain d7luoc1: 7luo C:2078-4309 [403524]
    automated match to d3ddqb1

Details for d7luoc1

PDB Entry: 7luo (more details), 3.17 Å

PDB Description: n-terminus of skp2 bound to cyclin a
PDB Compounds: (C:) S-phase kinase-associated protein 2,Cyclin-A2

SCOPe Domain Sequences for d7luoc1:

Sequence, based on SEQRES records: (download)

>d7luoc1 a.74.1.1 (C:2078-4309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dfvivrrgsgnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevg
eeyklqnetlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyit
ddtytkkqvlrmehlvlkvltfdlaap

Sequence, based on observed residues (ATOM records): (download)

>d7luoc1 a.74.1.1 (C:2078-4309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dfvivrrgsgnevpddihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeey
klqnetlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddt
ytkkqvlrmehlvlkvltfdlaap

SCOPe Domain Coordinates for d7luoc1:

Click to download the PDB-style file with coordinates for d7luoc1.
(The format of our PDB-style files is described here.)

Timeline for d7luoc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7luoc2