Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Neutrophil collagenase (MMP-8) [55532] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55533] (23 PDB entries) |
Domain d1mmba_: 1mmb A: [40352] complexed with bat, ca, zn |
PDB Entry: 1mmb (more details), 2.1 Å
SCOPe Domain Sequences for d1mmba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mmba_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg lahssdpgalmypnyafretsnyslpqddidgiqaiyg
Timeline for d1mmba_: