Lineage for d1mmba_ (1mmb A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1917931Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1918172Protein Neutrophil collagenase (MMP-8) [55532] (1 species)
  7. 1918173Species Human (Homo sapiens) [TaxId:9606] [55533] (23 PDB entries)
  8. 1918189Domain d1mmba_: 1mmb A: [40352]
    complexed with bat, ca, zn

Details for d1mmba_

PDB Entry: 1mmb (more details), 2.1 Å

PDB Description: complex of bb94 with the catalytic domain of matrix metalloproteinase-8
PDB Compounds: (A:) matrix metalloproteinase-8

SCOPe Domain Sequences for d1mmba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmba_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]}
npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq
rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
lahssdpgalmypnyafretsnyslpqddidgiqaiyg

SCOPe Domain Coordinates for d1mmba_:

Click to download the PDB-style file with coordinates for d1mmba_.
(The format of our PDB-style files is described here.)

Timeline for d1mmba_: