Lineage for d1mmb__ (1mmb -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) 
Protein Neutrophil collagenase (MMP-8) [55532] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55533] (10 PDB entries) 
Domain d1mmb__: 1mmb - [40352]
Details for d1mmb__
PDB Entry: 1mmb (more details), 2.1 Å
PDB Description: complex of bb94 with the catalytic domain of matrix metalloproteinase-8
SCOP Domain Sequences for d1mmb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mmb__ d.92.1.11 (-) Neutrophil collagenase (MMP-8) {Human (Homo sapiens)}
npkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadiniafyq
rdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahefghslg
lahssdpgalmypnyafretsnyslpqddidgiqaiyg
SCOP Domain Coordinates for d1mmb__:
Click to download the PDB-style file with coordinates for d1mmb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mmb__:
- d1mmb__ appears in SCOP 1.57
- d1mmb__ appears in the current release, SCOPe 2.08, called d1mmba_
View in 3D