Lineage for d7lvqb2 (7lvq B:244-429)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2566410Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries)
  8. 2566483Domain d7lvqb2: 7lvq B:244-429 [403505]
    Other proteins in same PDB: d7lvqa1, d7lvqb1, d7lvqk1, d7lvqk2
    automated match to d3rycd2
    complexed with anp, gdp, gtp, mg, ta1

Details for d7lvqb2

PDB Entry: 7lvq (more details), 2.9 Å

PDB Description: kif14[391-743] - amp-pnp closed state class in complex with a microtubule
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d7lvqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lvqb2 d.79.2.1 (B:244-429) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdat

SCOPe Domain Coordinates for d7lvqb2:

Click to download the PDB-style file with coordinates for d7lvqb2.
(The format of our PDB-style files is described here.)

Timeline for d7lvqb2: