SCOPe 2.07: Domain d7lvqb2: 7lvq B:244-429

Lineage for d7lvqb2 (7lvq B:244-429)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries)

8. Domain d7lvqb2: 7lvq B:244-429 [403505]
   Other proteins in same PDB: d7lvqa1, d7lvqb1, d7lvqk1, d7lvqk2
   automated match to d3rycd2
   complexed with anp, gdp, gtp, mg, ta1

Details for d7lvqb2

PDB Entry: 7lvq, 2.9 Å

PDB Description: kif14[391-743] - amp-pnp closed state class in complex with a microtubule

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d7lvqb2:

Sequence; same for both SEQRES and ATOM records:

>d7lvqb2 d.79.2.1 (B:244-429) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdat

Timeline for d7lvqb2:

• d7lvqb2 is new in SCOPe 2.07-stable
  
• d7lvqb2 appears in the current release, SCOPe 2.08