Lineage for d1kbca_ (1kbc A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135687Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 135688Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 135817Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (10 proteins)
  6. 135866Protein Neutrophil collagenase (MMP-8) [55532] (1 species)
  7. 135867Species Human (Homo sapiens) [TaxId:9606] [55533] (14 PDB entries)
  8. 135872Domain d1kbca_: 1kbc A: [40350]

Details for d1kbca_

PDB Entry: 1kbc (more details), 1.81 Å

PDB Description: procarboxypeptidase ternary complex

SCOP Domain Sequences for d1kbca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbca_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens)}
fmltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadi
niafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahe
fghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg

SCOP Domain Coordinates for d1kbca_:

Click to download the PDB-style file with coordinates for d1kbca_.
(The format of our PDB-style files is described here.)

Timeline for d1kbca_: