Lineage for d7lnoa_ (7lno A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014356Species Clostridioides difficile [TaxId:1496] [372824] (9 PDB entries)
  8. 3014358Domain d7lnoa_: 7lno A: [403491]
    automated match to d3isga_
    complexed with mpd, so4

Details for d7lnoa_

PDB Entry: 7lno (more details), 1.58 Å

PDB Description: structure of apo-cdd-1 beta-lactamase in imidazole and mpd
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d7lnoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lnoa_ e.3.1.0 (A:) automated matches {Clostridioides difficile [TaxId: 1496]}
vnivdysdcfegisggaifcntknkeyniynkelietrrspcstfkivstliglekgvin
skesvmgydgtdypnknwnknlsleeafkescvwyykklinkvdaksvqnilddlkygnc
disewegdlkngkghlngfwlesslqispkeqvqtmakifegdtnfkkehinilrdimai
dvndaninvygktgtgfdeknkrvdawfvgmleregdtyyfaiksddsnkeitgpkvkei
ainiikkyys

SCOPe Domain Coordinates for d7lnoa_:

Click to download the PDB-style file with coordinates for d7lnoa_.
(The format of our PDB-style files is described here.)

Timeline for d7lnoa_: