Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Clostridioides difficile [TaxId:1496] [372824] (9 PDB entries) |
Domain d7lnoa_: 7lno A: [403491] automated match to d3isga_ complexed with mpd, so4 |
PDB Entry: 7lno (more details), 1.58 Å
SCOPe Domain Sequences for d7lnoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7lnoa_ e.3.1.0 (A:) automated matches {Clostridioides difficile [TaxId: 1496]} vnivdysdcfegisggaifcntknkeyniynkelietrrspcstfkivstliglekgvin skesvmgydgtdypnknwnknlsleeafkescvwyykklinkvdaksvqnilddlkygnc disewegdlkngkghlngfwlesslqispkeqvqtmakifegdtnfkkehinilrdimai dvndaninvygktgtgfdeknkrvdawfvgmleregdtyyfaiksddsnkeitgpkvkei ainiikkyys
Timeline for d7lnoa_: