Lineage for d1bzsa_ (1bzs A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) 
Protein Neutrophil collagenase (MMP-8) [55532] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55533] (10 PDB entries) 
Domain d1bzsa_: 1bzs A: [40348]
Details for d1bzsa_
PDB Entry: 1bzs (more details), 1.7 Å
PDB Description: crystal structure of mmp8 complexed with hmr2909
SCOP Domain Sequences for d1bzsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzsa_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens)}
fmltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadi
niafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahe
fghslglahssdpgalmypnyafretsnyslpqddidgiqaiygd
SCOP Domain Coordinates for d1bzsa_:
Click to download the PDB-style file with coordinates for d1bzsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bzsa_:
- d1bzsa_ appears in SCOP 1.57
- d1bzsa_ appears in the current release, SCOPe 2.08
View in 3D