![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) |
![]() | Protein Neutrophil collagenase (MMP-8) [55532] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55533] (10 PDB entries) |
![]() | Domain d1bzsa_: 1bzs A: [40348] |
PDB Entry: 1bzs (more details), 1.7 Å
SCOP Domain Sequences for d1bzsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzsa_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens)} fmltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadi niafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahe fghslglahssdpgalmypnyafretsnyslpqddidgiqaiygd
Timeline for d1bzsa_: