Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries) |
Domain d7cj0b_: 7cj0 B: [403477] Other proteins in same PDB: d7cj0c_, d7cj0f_ automated match to d4uuza_ protein/DNA complex; complexed with gol |
PDB Entry: 7cj0 (more details), 2.5 Å
SCOPe Domain Sequences for d7cj0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cj0b_ a.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakrvt impkdiqlarrirgera
Timeline for d7cj0b_: