Lineage for d7cj0b_ (7cj0 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698677Protein automated matches [193445] (8 species)
    not a true protein
  7. 2698749Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries)
  8. 2698819Domain d7cj0b_: 7cj0 B: [403477]
    Other proteins in same PDB: d7cj0c_, d7cj0f_
    automated match to d4uuza_
    protein/DNA complex; complexed with gol

Details for d7cj0b_

PDB Entry: 7cj0 (more details), 2.5 Å

PDB Description: crystal structure of dnajc9 hbd in complex with h3.3-h4 dimer and mcm2 hbd
PDB Compounds: (B:) Histone H3.3

SCOPe Domain Sequences for d7cj0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cj0b_ a.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakrvt
impkdiqlarrirgera

SCOPe Domain Coordinates for d7cj0b_:

Click to download the PDB-style file with coordinates for d7cj0b_.
(The format of our PDB-style files is described here.)

Timeline for d7cj0b_: