SCOPe 2.07: Domain d7luoa1: 7luo A:2078-4309

Lineage for d7luoa1 (7luo A:2078-4309)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47958] (11 PDB entries)

8. Domain d7luoa1: 7luo A:2078-4309 [403472]
   automated match to d3ddqb1

Details for d7luoa1

PDB Entry: 7luo, 3.17 Å

PDB Description: n-terminus of skp2 bound to cyclin a

PDB Compounds: (A:) S-phase kinase-associated protein 2,Cyclin-A2

SCOPe Domain Sequences for d7luoa1:

Sequence, based on SEQRES records:

>d7luoa1 a.74.1.1 (A:2078-4309) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dfvivrrgsgnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevg
eeyklqnetlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyit
ddtytkkqvlrmehlvlkvltfdlaap

Sequence, based on observed residues (ATOM records):

>d7luoa1 a.74.1.1 (A:2078-4309) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dfvivrrgsgnevpddihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeey
klqnetlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddt
ytkkqvlrmehlvlkvltfdlaap

Timeline for d7luoa1:

• d7luoa1 is new in SCOPe 2.07-stable
  
• d7luoa1 appears in the current release, SCOPe 2.08