![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein Cyclin A [47956] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries) Uniprot P20248 175-432 |
![]() | Domain d7luoa1: 7luo A:2078-4309 [403472] automated match to d3ddqb1 |
PDB Entry: 7luo (more details), 3.17 Å
SCOPe Domain Sequences for d7luoa1:
Sequence, based on SEQRES records: (download)
>d7luoa1 a.74.1.1 (A:2078-4309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} dfvivrrgsgnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevg eeyklqnetlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyit ddtytkkqvlrmehlvlkvltfdlaap
>d7luoa1 a.74.1.1 (A:2078-4309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} dfvivrrgsgnevpddihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeey klqnetlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddt ytkkqvlrmehlvlkvltfdlaap
Timeline for d7luoa1: