![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
![]() | Protein Fibroblast collagenase (MMP-1) [55529] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [55531] (1 PDB entry) |
![]() | Domain d1fbla2: 1fbl A:100-271 [40347] Other proteins in same PDB: d1fbla1 complexed with ca, hta, zn |
PDB Entry: 1fbl (more details), 2.5 Å
SCOPe Domain Sequences for d1fbla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fbla2 d.92.1.11 (A:100-271) Fibroblast collagenase (MMP-1) {Pig (Sus scrofa) [TaxId: 9823]} fvltpgnprwenthltyrienytpdlsredvdraiekafqlwsnvspltftkvsegqadi misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtknfrdynlyrvaahe lghslglshstdigalmypnyiytgdvqlsqddidgiqaiygpsenpvqpsg
Timeline for d1fbla2: