SCOP 1.57: Domain d1fbl_2: 1fbl 100-271

Lineage for d1fbl_2 (1fbl 100-271)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (8 proteins)

6. Protein Fibroblast collagenase (MMP-1) [55529] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [55531] (1 PDB entry)

8. Domain d1fbl_2: 1fbl 100-271 [40347]
   Other proteins in same PDB: d1fbl_1

Details for d1fbl_2

PDB Entry: 1fbl, 2.5 Å

PDB Description: structure of full-length porcine synovial collagenase (mmp1) reveals a c-terminal domain containing a calcium-linked, four-bladed beta-propeller

SCOP Domain Sequences for d1fbl_2:

Sequence; same for both SEQRES and ATOM records:

>d1fbl_2 d.92.1.11 (100-271) Fibroblast collagenase (MMP-1) {Pig (Sus scrofa)}
fvltpgnprwenthltyrienytpdlsredvdraiekafqlwsnvspltftkvsegqadi
misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtknfrdynlyrvaahe
lghslglshstdigalmypnyiytgdvqlsqddidgiqaiygpsenpvqpsg

Timeline for d1fbl_2:

• d1fbl_2 first appeared (with stable ids) in SCOP 1.55
  
• d1fbl_2 appears in SCOP 1.59
  
• d1fbl_2 appears in the current release, SCOPe 2.08, called d1fbla2