Lineage for d1fbl_2 (1fbl 100-271)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34307Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 34308Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) (S)
  5. 34427Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins)
  6. 34437Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 34451Species Pig (Sus scrofa) [TaxId:9823] [55531] (1 PDB entry)
  8. 34452Domain d1fbl_2: 1fbl 100-271 [40347]
    Other proteins in same PDB: d1fbl_1

Details for d1fbl_2

PDB Entry: 1fbl (more details), 2.5 Å

PDB Description: structure of full-length porcine synovial collagenase (mmp1) reveals a c-terminal domain containing a calcium-linked, four-bladed beta-propeller

SCOP Domain Sequences for d1fbl_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbl_2 d.92.1.11 (100-271) Fibroblast collagenase (MMP-1) {Pig (Sus scrofa)}
fvltpgnprwenthltyrienytpdlsredvdraiekafqlwsnvspltftkvsegqadi
misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtknfrdynlyrvaahe
lghslglshstdigalmypnyiytgdvqlsqddidgiqaiygpsenpvqpsg

SCOP Domain Coordinates for d1fbl_2:

Click to download the PDB-style file with coordinates for d1fbl_2.
(The format of our PDB-style files is described here.)

Timeline for d1fbl_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fbl_1