Lineage for d1fbla2 (1fbl A:100-271)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. Species Pig (Sus scrofa) [TaxId:9823] [55531] (1 PDB entry)
  8. Domain d1fbla2: 1fbl A:100-271 [40347]
    Other proteins in same PDB: d1fbla1
    complexed with ca, hta, zn

Details for d1fbla2

PDB Entry: 1fbl (more details), 2.5 Å

PDB Description: structure of full-length porcine synovial collagenase (mmp1) reveals a c-terminal domain containing a calcium-linked, four-bladed beta-propeller
PDB Compounds: (A:) fibroblast (interstitial) collagenase (mmp-1)

SCOPe Domain Sequences for d1fbla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbla2 d.92.1.11 (A:100-271) Fibroblast collagenase (MMP-1) {Pig (Sus scrofa) [TaxId: 9823]}
fvltpgnprwenthltyrienytpdlsredvdraiekafqlwsnvspltftkvsegqadi
misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtknfrdynlyrvaahe
lghslglshstdigalmypnyiytgdvqlsqddidgiqaiygpsenpvqpsg

SCOPe Domain Coordinates for d1fbla2 are not available.

Timeline for d1fbla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fbla1