Lineage for d4ayka_ (4ayk A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331858Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 331859Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 332044Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins)
  6. 332057Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 332058Species Human (Homo sapiens) [TaxId:9606] [55530] (10 PDB entries)
  8. 332069Domain d4ayka_: 4ayk A: [40346]
    complexed with ca, cgs, zn

Details for d4ayka_

PDB Entry: 4ayk (more details)

PDB Description: catalytic fragment of human fibroblast collagenase complexed with cgs- 27023a, nmr, 30 structures

SCOP Domain Sequences for d4ayka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ayka_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
vltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadim
isfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahel
ghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp

SCOP Domain Coordinates for d4ayka_:

Click to download the PDB-style file with coordinates for d4ayka_.
(The format of our PDB-style files is described here.)

Timeline for d4ayka_: