![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins) |
![]() | Protein Fibroblast collagenase (MMP-1) [55529] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55530] (10 PDB entries) |
![]() | Domain d4ayka_: 4ayk A: [40346] |
PDB Entry: 4ayk (more details)
SCOP Domain Sequences for d4ayka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ayka_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)} vltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadim isfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahel ghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp
Timeline for d4ayka_: