Lineage for d2ayka_ (2ayk A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 867615Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) (S)
  5. 867875Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 867917Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 867918Species Human (Homo sapiens) [TaxId:9606] [55530] (12 PDB entries)
    Uniprot P03956 32-466
  8. 867934Domain d2ayka_: 2ayk A: [40344]
    complexed with ca, zn

Details for d2ayka_

PDB Entry: 2ayk (more details)

PDB Description: inhibitor-free catalytic fragment of human fibroblast collagenase, nmr, minimized average structure
PDB Compounds: (A:) collagenase

SCOP Domain Sequences for d2ayka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ayka_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]}
prweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrg
dhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslgl
shstdigalmypsytfsgdvqlaqddidgiqaiygrs

SCOP Domain Coordinates for d2ayka_:

Click to download the PDB-style file with coordinates for d2ayka_.
(The format of our PDB-style files is described here.)

Timeline for d2ayka_: