SCOP 1.63: Domain d2ayk__: 2ayk -

Lineage for d2ayk__ (2ayk -)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins)

6. Protein Fibroblast collagenase (MMP-1) [55529] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55530] (10 PDB entries)

8. Domain d2ayk__: 2ayk - [40344]
   complexed with ca, zn

Details for d2ayk__

PDB Entry: 2ayk

PDB Description: inhibitor-free catalytic fragment of human fibroblast collagenase, nmr, minimized average structure

SCOP Domain Sequences for d2ayk__:

Sequence; same for both SEQRES and ATOM records:

>d2ayk__ d.92.1.11 (-) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
prweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrg
dhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslgl
shstdigalmypsytfsgdvqlaqddidgiqaiygrs

Timeline for d2ayk__:

• d2ayk__ first appeared (with stable ids) in SCOP 1.55
  
• d2ayk__ appears in SCOP 1.61
  
• d2ayk__ appears in SCOP 1.65
  
• d2ayk__ appears in the current release, SCOPe 2.08, called d2ayka_