Lineage for d2ayk__ (2ayk -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (8 proteins) 
Protein Fibroblast collagenase (MMP-1) [55529] (2 species) Species Human (Homo sapiens) [TaxId:9606] [55530] (10 PDB entries) 
Domain d2ayk__: 2ayk - [40344]
Details for d2ayk__
PDB Entry: 2ayk (more details)
PDB Description: inhibitor-free catalytic fragment of human fibroblast collagenase, nmr, minimized average structure
SCOP Domain Sequences for d2ayk__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ayk__ d.92.1.11 (-) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
prweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrg
dhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslgl
shstdigalmypsytfsgdvqlaqddidgiqaiygrs
SCOP Domain Coordinates for d2ayk__:
Click to download the PDB-style file with coordinates for d2ayk__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ayk__:
- d2ayk__ first appeared (with stable ids) in SCOP 1.55
- d2ayk__ appears in SCOP 1.59
- d2ayk__ appears in the current release, SCOPe 2.08, called d2ayka_
View in 3D