SCOP 1.63: Domain d1cglb_: 1cgl B:

Lineage for d1cglb_ (1cgl B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins)

6. Protein Fibroblast collagenase (MMP-1) [55529] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55530] (10 PDB entries)

8. Domain d1cglb_: 1cgl B: [40342]
   complexed with ca, cbz, emr, zn

Details for d1cglb_

PDB Entry: 1cgl, 2.4 Å

PDB Description: structure of the catalytic domain of fibroblast collagenase complexed with an inhibitor

SCOP Domain Sequences for d1cglb_:

Sequence, based on SEQRES records:

>d1cglb_ d.92.1.11 (B:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
nprweqthlryrienytpdlpradvdhaiekafqlwsdvtpltftkvsegqadimisfvr
gdhrdnspfdgpggnlahafdpgpgiggdahfdederwtnnfreynlhrvaahelghslg
lshstdigalmypsytfsgdvqlaqddidgiqaiygrsqn

Sequence, based on observed residues (ATOM records):

>d1cglb_ d.92.1.11 (B:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
nprweqthlryrienytpdlpradvdhaiekafqlwsdvtpltftkvqadimisfvrgdh
rdnspfdgpggnlahafdpgpgiggdahfdederwtnnfreynlhrvaahelghslglsh
stdigalmypsytfsgdvqlaqddidgiqaiygrsqn

Timeline for d1cglb_:

• d1cglb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cglb_ appears in SCOP 1.61
  
• d1cglb_ appears in SCOP 1.65
  
• d1cglb_ appears in the current release, SCOPe 2.08