Lineage for d1cglb_ (1cgl B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259924Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 259925Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 260095Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins)
  6. 260108Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 260109Species Human (Homo sapiens) [TaxId:9606] [55530] (10 PDB entries)
  8. 260117Domain d1cglb_: 1cgl B: [40342]
    complexed with ca, cbz, emr, zn

Details for d1cglb_

PDB Entry: 1cgl (more details), 2.4 Å

PDB Description: structure of the catalytic domain of fibroblast collagenase complexed with an inhibitor

SCOP Domain Sequences for d1cglb_:

Sequence, based on SEQRES records: (download)

>d1cglb_ d.92.1.11 (B:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
nprweqthlryrienytpdlpradvdhaiekafqlwsdvtpltftkvsegqadimisfvr
gdhrdnspfdgpggnlahafdpgpgiggdahfdederwtnnfreynlhrvaahelghslg
lshstdigalmypsytfsgdvqlaqddidgiqaiygrsqn

Sequence, based on observed residues (ATOM records): (download)

>d1cglb_ d.92.1.11 (B:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
nprweqthlryrienytpdlpradvdhaiekafqlwsdvtpltftkvqadimisfvrgdh
rdnspfdgpggnlahafdpgpgiggdahfdederwtnnfreynlhrvaahelghslglsh
stdigalmypsytfsgdvqlaqddidgiqaiygrsqn

SCOP Domain Coordinates for d1cglb_:

Click to download the PDB-style file with coordinates for d1cglb_.
(The format of our PDB-style files is described here.)

Timeline for d1cglb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cgla_