Lineage for d1cgla_ (1cgl A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82192Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 82193Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families) (S)
  5. 82321Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (8 proteins)
  6. 82334Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 82335Species Human (Homo sapiens) [TaxId:9606] [55530] (10 PDB entries)
  8. 82342Domain d1cgla_: 1cgl A: [40341]

Details for d1cgla_

PDB Entry: 1cgl (more details), 2.4 Å

PDB Description: structure of the catalytic domain of fibroblast collagenase complexed with an inhibitor

SCOP Domain Sequences for d1cgla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgla_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
vltegnprweqthlryrienytpdlpradvdhaiekafqlwsdvtpltftkvsegqadim
isfvrgdhrdnspfdgpggnlahafdpgpgiggdahfdederwtnnfreynlhrvaahel
ghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvq

SCOP Domain Coordinates for d1cgla_:

Click to download the PDB-style file with coordinates for d1cgla_.
(The format of our PDB-style files is described here.)

Timeline for d1cgla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cglb_