Lineage for d7kcca1 (7kcc A:14-125)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582827Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins)
  6. 2582828Protein S-adenosylmethionine synthetase [55975] (3 species)
    synonym: methionine adenosyltransferase, MAT
  7. 2582878Species Human (Homo sapiens), isoform type-2 [TaxId:9606] [160759] (8 PDB entries)
    Uniprot P31153 126-251! Uniprot P31153 16-125! Uniprot P31153 252-395
    MAT2A
  8. 2582897Domain d7kcca1: 7kcc A:14-125 [403400]
    automated match to d2p02a1
    complexed with cl, edo, sam, wbg

Details for d7kcca1

PDB Entry: 7kcc (more details), 1.32 Å

PDB Description: crystal structure of human methionine adenosyltransferase 2a (mat2a) in complex with sam and allosteric inhibitor ag-270
PDB Compounds: (A:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d7kcca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kcca1 d.130.1.1 (A:14-125) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]}
eegtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetvaktgmillageits
raavdyqkvvreavkhigyddsskgfdyktcnvlvaleqqspdiaqgvhldr

SCOPe Domain Coordinates for d7kcca1:

Click to download the PDB-style file with coordinates for d7kcca1.
(The format of our PDB-style files is described here.)

Timeline for d7kcca1: