SCOP 1.75: Domain d1cgfb_: 1cgf B:

Lineage for d1cgfb_ (1cgf B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Fibroblast collagenase (MMP-1) [55529] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55530] (12 PDB entries)
   Uniprot P03956 32-466

8. Domain d1cgfb_: 1cgf B: [40340]
   complexed with ca, zn

Details for d1cgfb_

PDB Entry: 1cgf, 2.1 Å

PDB Description: crystal structures of recombinant 19-kda human fibroblast collagenase complexed to itself

PDB Compounds: (B:) fibroblast collagenase

SCOP Domain Sequences for d1cgfb_:

Sequence; same for both SEQRES and ATOM records:

>d1cgfb_ d.92.1.11 (B:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]}
ltegnprweqthlryrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimi
sfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelg
hslglshstdigalmypsytfsgdvqlaqddidgiqaiygrs

Timeline for d1cgfb_:

• d1cgfb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cgfb_ appears in SCOP 1.73
  
• d1cgfb_ appears in SCOPe 2.01
  
• d1cgfb_ appears in the current release, SCOPe 2.08