Lineage for d1cgfb_ (1cgf B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135687Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 135688Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 135817Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (10 proteins)
  6. 135830Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 135831Species Human (Homo sapiens) [TaxId:9606] [55530] (10 PDB entries)
  8. 135837Domain d1cgfb_: 1cgf B: [40340]

Details for d1cgfb_

PDB Entry: 1cgf (more details), 2.1 Å

PDB Description: crystal structures of recombinant 19-kda human fibroblast collagenase complexed to itself

SCOP Domain Sequences for d1cgfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgfb_ d.92.1.11 (B:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
ltegnprweqthlryrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimi
sfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelg
hslglshstdigalmypsytfsgdvqlaqddidgiqaiygrs

SCOP Domain Coordinates for d1cgfb_:

Click to download the PDB-style file with coordinates for d1cgfb_.
(The format of our PDB-style files is described here.)

Timeline for d1cgfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cgfa_