Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d7jtrh2: 7jtr H:130-243 [403390] Other proteins in same PDB: d7jtra_, d7jtrb3, d7jtrc_, d7jtrd3, d7jtre_, d7jtrf3, d7jtrg_, d7jtrh3 automated match to d1h8sa1 complexed with cl |
PDB Entry: 7jtr (more details), 2.5 Å
SCOPe Domain Sequences for d7jtrh2:
Sequence, based on SEQRES records: (download)
>d7jtrh2 b.1.1.0 (H:130-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divmtqspsslamsvgqkvtmsckssqsllinnnqknylawyqqkpgqspkllvyfastr esgvpdrfigsgsgtdftltissvqaedladyfcqqhftapytfgggtkleikr
>d7jtrh2 b.1.1.0 (H:130-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divmtqspsslamsvgqkvtmsckssqsllinknylawyqqkpgqspkllvyfastresg vpdrfigsgsgtdftltissvqaedladyfcqqhftapytfgggtkleikr
Timeline for d7jtrh2: