Lineage for d7jtrh2 (7jtr H:130-243)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370438Domain d7jtrh2: 7jtr H:130-243 [403390]
    Other proteins in same PDB: d7jtra_, d7jtrb3, d7jtrc_, d7jtrd3, d7jtre_, d7jtrf3, d7jtrg_, d7jtrh3
    automated match to d1h8sa1
    complexed with cl

Details for d7jtrh2

PDB Entry: 7jtr (more details), 2.5 Å

PDB Description: complex of maltose-binding protein (mbp) with single-chain fv (scfv)
PDB Compounds: (H:) single-chain Fv antibody fragment (scFv)

SCOPe Domain Sequences for d7jtrh2:

Sequence, based on SEQRES records: (download)

>d7jtrh2 b.1.1.0 (H:130-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspsslamsvgqkvtmsckssqsllinnnqknylawyqqkpgqspkllvyfastr
esgvpdrfigsgsgtdftltissvqaedladyfcqqhftapytfgggtkleikr

Sequence, based on observed residues (ATOM records): (download)

>d7jtrh2 b.1.1.0 (H:130-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspsslamsvgqkvtmsckssqsllinknylawyqqkpgqspkllvyfastresg
vpdrfigsgsgtdftltissvqaedladyfcqqhftapytfgggtkleikr

SCOPe Domain Coordinates for d7jtrh2:

Click to download the PDB-style file with coordinates for d7jtrh2.
(The format of our PDB-style files is described here.)

Timeline for d7jtrh2: