Lineage for d1cgfa_ (1cgf A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570846Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2570956Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 2570957Species Human (Homo sapiens) [TaxId:9606] [55530] (13 PDB entries)
    Uniprot P03956 32-466
  8. 2570962Domain d1cgfa_: 1cgf A: [40339]
    complexed with ca, zn

Details for d1cgfa_

PDB Entry: 1cgf (more details), 2.1 Å

PDB Description: crystal structures of recombinant 19-kda human fibroblast collagenase complexed to itself
PDB Compounds: (A:) fibroblast collagenase

SCOPe Domain Sequences for d1cgfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgfa_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]}
ltegnprweqthlryrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimi
sfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelg
hslglshstdigalmypsytfsgdvqlaqddidgiqaiygrs

SCOPe Domain Coordinates for d1cgfa_:

Click to download the PDB-style file with coordinates for d1cgfa_.
(The format of our PDB-style files is described here.)

Timeline for d1cgfa_: