Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins) |
Protein Fibroblast collagenase (MMP-1) [55529] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [55530] (12 PDB entries) Uniprot P03956 32-466 |
Domain d1cgfa_: 1cgf A: [40339] |
PDB Entry: 1cgf (more details), 2.1 Å
SCOP Domain Sequences for d1cgfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cgfa_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} ltegnprweqthlryrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimi sfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelg hslglshstdigalmypsytfsgdvqlaqddidgiqaiygrs
Timeline for d1cgfa_: