Lineage for d1cgfa_ (1cgf A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) Protein Fibroblast collagenase (MMP-1) [55529] (2 species) Species Human (Homo sapiens) [TaxId:9606] [55530] (10 PDB entries) 
Domain d1cgfa_: 1cgf A: [40339]
Details for d1cgfa_
PDB Entry: 1cgf (more details), 2.1 Å
PDB Description: crystal structures of recombinant 19-kda human fibroblast collagenase complexed to itself
SCOP Domain Sequences for d1cgfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cgfa_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
ltegnprweqthlryrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimi
sfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelg
hslglshstdigalmypsytfsgdvqlaqddidgiqaiygrs
SCOP Domain Coordinates for d1cgfa_:
Click to download the PDB-style file with coordinates for d1cgfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cgfa_:
- d1cgfa_ appears in SCOP 1.57
- d1cgfa_ appears in the current release, SCOPe 2.08
View in 3D
