SCOP 1.73: Domain d966ca_: 966c A:

Lineage for d966ca_ (966c A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Fibroblast collagenase (MMP-1) [55529] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55530] (12 PDB entries)

8. Domain d966ca_: 966c A: [40338]
   complexed with ca, rs2, zn

Details for d966ca_

PDB Entry: 966c, 1.9 Å

PDB Description: crystal structure of fibroblast collagenase-1 complexed to a diphenyl- ether sulphone based hydroxamic acid

PDB Compounds: (A:) mmp-1

SCOP Domain Sequences for d966ca_:

Sequence; same for both SEQRES and ATOM records:

>d966ca_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]}
rweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrgd
hrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslgls
hstdigalmypsytfsgdvqlaqddidgiqaiygrsq

Timeline for d966ca_:

• d966ca_ first appeared (with stable ids) in SCOP 1.55, called d966c__
  
• d966ca_ was called d966c__ in SCOP 1.71
  
• d966ca_ appears in SCOP 1.75
  
• d966ca_ appears in the current release, SCOPe 2.08