Lineage for d966c__ (966c -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607530Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 607531Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 607753Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 607766Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 607767Species Human (Homo sapiens) [TaxId:9606] [55530] (11 PDB entries)
  8. 607771Domain d966c__: 966c - [40338]
    complexed with ca, rs2, zn

Details for d966c__

PDB Entry: 966c (more details), 1.9 Å

PDB Description: crystal structure of fibroblast collagenase-1 complexed to a diphenyl- ether sulphone based hydroxamic acid

SCOP Domain Sequences for d966c__:

Sequence; same for both SEQRES and ATOM records: (download)

>d966c__ d.92.1.11 (-) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
rweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrgd
hrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslgls
hstdigalmypsytfsgdvqlaqddidgiqaiygrsq

SCOP Domain Coordinates for d966c__:

Click to download the PDB-style file with coordinates for d966c__.
(The format of our PDB-style files is described here.)

Timeline for d966c__: