SCOPe 2.08: Domain d7jtrb2: 7jtr B:130-242

Lineage for d7jtrb2 (7jtr B:130-242)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d7jtrb2: 7jtr B:130-242 [403377]
   Other proteins in same PDB: d7jtra_, d7jtrb3, d7jtrc_, d7jtrd3, d7jtre_, d7jtrf3, d7jtrg_, d7jtrh3
   automated match to d1h8sa1
   complexed with cl

Details for d7jtrb2

PDB Entry: 7jtr, 2.5 Å

PDB Description: complex of maltose-binding protein (mbp) with single-chain fv (scfv)

PDB Compounds: (B:) single-chain Fv antibody fragment (scFv)

SCOPe Domain Sequences for d7jtrb2:

Sequence, based on SEQRES records:

>d7jtrb2 b.1.1.0 (B:130-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspsslamsvgqkvtmsckssqsllinnnqknylawyqqkpgqspkllvyfastr
esgvpdrfigsgsgtdftltissvqaedladyfcqqhftapytfgggtkleik

Sequence, based on observed residues (ATOM records):

>d7jtrb2 b.1.1.0 (B:130-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspsslamsvgqkvtmsckssqsllinqknylawyqqkpgqspkllvyfastres
gvpdrfigsgsgtdftltissvqaedladyfcqqhftapytfgggtkleik

Timeline for d7jtrb2:

• d7jtrb2 first appeared in SCOPe 2.07