SCOP 1.61: Domain d2tcl__: 2tcl -

Lineage for d2tcl__ (2tcl -)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins)

6. Protein Fibroblast collagenase (MMP-1) [55529] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55530] (10 PDB entries)

8. Domain d2tcl__: 2tcl - [40337]

Details for d2tcl__

PDB Entry: 2tcl, 2.2 Å

PDB Description: structure of the catalytic domain of human fibroblast collagenase complexed with an inhibitor

SCOP Domain Sequences for d2tcl__:

Sequence; same for both SEQRES and ATOM records:

>d2tcl__ d.92.1.11 (-) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
ltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimi
sfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelg
hslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsq

Timeline for d2tcl__:

• d2tcl__ first appeared (with stable ids) in SCOP 1.55
  
• d2tcl__ appears in SCOP 1.59
  
• d2tcl__ appears in SCOP 1.63
  
• d2tcl__ appears in the current release, SCOPe 2.08, called d2tcla_