Lineage for d1cgea_ (1cge A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729341Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)
  6. 729371Protein Fibroblast collagenase (MMP-1) [55529] (2 species)
  7. 729372Species Human (Homo sapiens) [TaxId:9606] [55530] (12 PDB entries)
  8. 729374Domain d1cgea_: 1cge A: [40336]
    complexed with ca, zn

Details for d1cgea_

PDB Entry: 1cge (more details), 1.9 Å

PDB Description: crystal structures of recombinant 19-kda human fibroblast collagenase complexed to itself
PDB Compounds: (A:) fibroblast collagenase

SCOP Domain Sequences for d1cgea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgea_ d.92.1.11 (A:) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]}
ltegnprweqthlryrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimi
sfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelg
hslglshstdigalmypsytfsgdvqlaqddidgiqaiygrs

SCOP Domain Coordinates for d1cgea_:

Click to download the PDB-style file with coordinates for d1cgea_.
(The format of our PDB-style files is described here.)

Timeline for d1cgea_: