Lineage for d1hfc__ (1hfc -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) Protein Fibroblast collagenase (MMP-1) [55529] (2 species) Species Human (Homo sapiens) [TaxId:9606] [55530] (10 PDB entries) 
Domain d1hfc__: 1hfc - [40335]
Details for d1hfc__
PDB Entry: 1hfc (more details), 1.56 Å
PDB Description: 1.56 angstrom structure of mature truncated human fibroblast collagenase
SCOP Domain Sequences for d1hfc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfc__ d.92.1.11 (-) Fibroblast collagenase (MMP-1) {Human (Homo sapiens)}
prweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfvrg
dhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghslgl
shstdigalmypsytfsgdvqlaqddidgiqaiygrs
SCOP Domain Coordinates for d1hfc__:
Click to download the PDB-style file with coordinates for d1hfc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hfc__:
- d1hfc__ appears in SCOP 1.57
- d1hfc__ appears in the current release, SCOPe 2.08, called d1hfca_
View in 3D