Lineage for d1bkcc_ (1bkc C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34307Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 34308Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) (S)
  5. 34420Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (1 protein)
  6. 34421Protein TNF-alpha converting enzyme, TACE, catalytic domain [55526] (1 species)
  7. 34422Species Human (Homo sapiens) [TaxId:9606] [55527] (1 PDB entry)
  8. 34424Domain d1bkcc_: 1bkc C: [40332]

Details for d1bkcc_

PDB Entry: 1bkc (more details), 2 Å

PDB Description: catalytic domain of tnf-alpha converting enzyme (tace)

SCOP Domain Sequences for d1bkcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkcc_ d.92.1.10 (C:) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens)}
mkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiqie
qirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlfty
qdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltkead
lvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsiyk
tieskaqecfqers

SCOP Domain Coordinates for d1bkcc_:

Click to download the PDB-style file with coordinates for d1bkcc_.
(The format of our PDB-style files is described here.)

Timeline for d1bkcc_: