SCOP 1.69: Domain d1quaa_: 1qua A:

Lineage for d1quaa_ (1qua A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families)

5. Family d.92.1.9: Hemorrhagin [55519] (1 protein)

6. Protein Snake venom metalloprotease [55520] (7 species)

7. Species Chinese five-pace snake (Agkistrodon acutus), acutolysin C [TaxId:36307] [55524] (1 PDB entry)

8. Domain d1quaa_: 1qua A: [40330]

Details for d1quaa_

PDB Entry: 1qua, 2.2 Å

PDB Description: crystal structure of acutolysin-c, a hemorrhagic toxin from the snake venom of agkistrodon acutus, at 2.2 a resolution

SCOP Domain Sequences for d1quaa_:

Sequence; same for both SEQRES and ATOM records:

>d1quaa_ d.92.1.9 (A:) Snake venom metalloprotease {Chinese five-pace snake (Agkistrodon acutus), acutolysin C}
papqtsielflivdhsmyakynsnsskitttlkarvnimnaiysslnlvitlsgiemwsa
adlitvqsssrntlklfaswretdllkrtsndnaqlltatnfngntvglaylktmcnsky
svgliqdhsaipllmavtmahelghnlgmnhdgagcscatcimapvlssgpaksfsdcsk
hdyqsfltihkpqclln

Timeline for d1quaa_:

• d1quaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1quaa_ appears in SCOP 1.67
  
• d1quaa_ appears in SCOP 1.71
  
• d1quaa_ appears in the current release, SCOPe 2.08