Lineage for d1quaa_ (1qua A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331858Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 331859Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 332013Family d.92.1.9: Hemorrhagin [55519] (1 protein)
  6. 332014Protein Snake venom metalloprotease [55520] (5 species)
  7. 332015Species Chinese five-pace snake (Agkistrodon acutus), acutolysin C [TaxId:36307] [55524] (1 PDB entry)
  8. 332016Domain d1quaa_: 1qua A: [40330]
    complexed with zn

Details for d1quaa_

PDB Entry: 1qua (more details), 2.2 Å

PDB Description: crystal structure of acutolysin-c, a hemorrhagic toxin from the snake venom of agkistrodon acutus, at 2.2 a resolution

SCOP Domain Sequences for d1quaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1quaa_ d.92.1.9 (A:) Snake venom metalloprotease {Chinese five-pace snake (Agkistrodon acutus), acutolysin C}
papqtsielflivdhsmyakynsnsskitttlkarvnimnaiysslnlvitlsgiemwsa
adlitvqsssrntlklfaswretdllkrtsndnaqlltatnfngntvglaylktmcnsky
svgliqdhsaipllmavtmahelghnlgmnhdgagcscatcimapvlssgpaksfsdcsk
hdyqsfltihkpqclln

SCOP Domain Coordinates for d1quaa_:

Click to download the PDB-style file with coordinates for d1quaa_.
(The format of our PDB-style files is described here.)

Timeline for d1quaa_: