SCOPe 2.08: Domain d7couf_: 7cou F:

Lineage for d7couf_ (7cou F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [267725] (12 PDB entries)

8. Domain d7couf_: 7cou F: [403293]
   Other proteins in same PDB: d7coua_, d7coub_, d7couc_, d7coud_, d7coue_, d7couh_, d7coui_, d7couj_, d7couk_, d7coul_, d7coum_, d7couo_, d7cout_, d7couu_, d7couv_, d7coux_, d7couz_
   automated match to d3a0hf_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7couf_

PDB Entry: 7cou, 2.25 Å

PDB Description: structure of cyanobacterial photosystem ii in the dark s1 state

PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d7couf_:

Sequence; same for both SEQRES and ATOM records:

>d7couf_ f.23.38.1 (F:) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus vulcanus [TaxId: 32053]}
sypiftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d7couf_:

• d7couf_ first appeared in SCOPe 2.07