Lineage for d1bswa_ (1bsw A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607530Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 607531Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 607714Family d.92.1.9: Reprolysin-like [55519] (2 proteins)
    Pfam 01421
  6. 607719Protein Snake venom metalloprotease [55520] (7 species)
  7. 607727Species Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId:36307] [55523] (2 PDB entries)
  8. 607729Domain d1bswa_: 1bsw A: [40329]
    complexed with oc1, zn3

Details for d1bswa_

PDB Entry: 1bsw (more details), 1.95 Å

PDB Description: acutolysin a from snake venom of agkistrodon acutus at ph 7.5

SCOP Domain Sequences for d1bswa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bswa_ d.92.1.9 (A:) Snake venom metalloprotease {Five-pace snake (Agkistrodon acutus), acutolysin A}
fqrymeivivvdhsmvkkyngdsdsikawvyemintitesysylkidislsgleiwsgkd
lidveasagntlksfgewrakdlihrishdnaqlltatdfdgatiglayvasmcnpkrsv
gviqdhssvnrlvaitlahemahnlgvshdegscscggkscimspsisdetikyfsdcsy
iqcrdyiakenppciln

SCOP Domain Coordinates for d1bswa_:

Click to download the PDB-style file with coordinates for d1bswa_.
(The format of our PDB-style files is described here.)

Timeline for d1bswa_: