Lineage for d1bswa_ (1bsw A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194566Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 194567Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 194670Family d.92.1.9: Hemorrhagin [55519] (1 protein)
  6. 194671Protein Snake venom metalloprotease [55520] (5 species)
  7. 194679Species Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId:36307] [55523] (2 PDB entries)
  8. 194681Domain d1bswa_: 1bsw A: [40329]

Details for d1bswa_

PDB Entry: 1bsw (more details), 1.95 Å

PDB Description: acutolysin a from snake venom of agkistrodon acutus at ph 7.5

SCOP Domain Sequences for d1bswa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bswa_ d.92.1.9 (A:) Snake venom metalloprotease {Five-pace snake (Agkistrodon acutus), acutolysin A}
fqrymeivivvdhsmvkkyngdsdsikawvyemintitesysylkidislsgleiwsgkd
lidveasagntlksfgewrakdlihrishdnaqlltatdfdgatiglayvasmcnpkrsv
gviqdhssvnrlvaitlahemahnlgvshdegscscggkscimspsisdetikyfsdcsy
iqcrdyiakenppciln

SCOP Domain Coordinates for d1bswa_:

Click to download the PDB-style file with coordinates for d1bswa_.
(The format of our PDB-style files is described here.)

Timeline for d1bswa_: