SCOP 1.59: Domain d1buda_: 1bud A:

Lineage for d1buda_ (1bud A:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families)

5. Family d.92.1.9: Hemorrhagin [55519] (1 protein)

6. Protein Snake venom metalloprotease [55520] (4 species)

7. Species Five-pace snake (Agkistrodon acutus), acutolysin A [TaxId:36307] [55523] (2 PDB entries)

8. Domain d1buda_: 1bud A: [40328]

Details for d1buda_

PDB Entry: 1bud, 1.9 Å

PDB Description: acutolysin a from snake venom of agkistrodon acutus at ph 5.0

SCOP Domain Sequences for d1buda_:

Sequence; same for both SEQRES and ATOM records:

>d1buda_ d.92.1.9 (A:) Snake venom metalloprotease {Five-pace snake (Agkistrodon acutus), acutolysin A}
fqrymeivivvdhsmvkkyngdsdsikawvyemintitesysylkidislsgleiwsgkd
lidveasagntlksfgewrakdlihrishdnaqlltatdfdgatiglayvasmcnpkrsv
gviqdhssvnrlvaitlahemahnlgvshdegscscggkscimspsisdetikyfsdcsy
iqcrdyiskenppciln

Timeline for d1buda_:

• d1buda_ first appeared (with stable ids) in SCOP 1.55
  
• d1buda_ appears in SCOP 1.57
  
• d1buda_ appears in SCOP 1.61
  
• d1buda_ appears in the current release, SCOPe 2.08